Cytokeratin 19 (KRT19) Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0247
Artikelname: Cytokeratin 19 (KRT19) Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0247
Hersteller Artikelnummer: A0247
Alternativnummer: ABB-A0247-20UL,ABB-A0247-100UL,ABB-A0247-1000UL,ABB-A0247-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: K19, CK19, K1CS, Cytokeratin 19 (KRT19)
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 3880
UniProt: P08727
Reinheit: Affinity purification
Sequenz: ELAYLKKNHEEEISTLRGQVGGQVSVEVDSAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQA
Target-Kategorie: KRT19
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin,Stem Cells.