Cytokeratin 19 (KRT19) Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Cytokeratin 19 (KRT19) Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0247
• Hersteller Artikelnummer: A0247
• Alternativnummer: ABB-A0247-20UL,ABB-A0247-100UL,ABB-A0247-1000UL,ABB-A0247-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: K19, CK19, K1CS, Cytokeratin 19 (KRT19)

Produktbeschreibung

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 44kDa
• NCBI: 3880
• UniProt: P08727
• Reinheit: Affinity purification
• Sequenz: ELAYLKKNHEEEISTLRGQVGGQVSVEVDSAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQA
• Target-Kategorie: KRT19
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin,Stem Cells

Bilder