NME1/NM23A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NME1/NM23A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0259
• Hersteller Artikelnummer: A0259
• Alternativnummer: ABB-A0259-100UL,ABB-A0259-20UL,ABB-A0259-500UL,ABB-A0259-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NB, AWD, NBS, GAAD, NDKA, NM23, NDPKA, NDPK-A, NM23-H1, NME1/NM23A

Produktbeschreibung

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of A (encoded by this gene) and B (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 17kDa
• NCBI: 4830
• UniProt: P15531
• Reinheit: Affinity purification
• Sequenz: YVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
• Target-Kategorie: NME1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Apoptosis,Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders

Bilder