[KO Validated] p53 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0263
- Bilder (2)
| Artikelname: | [KO Validated] p53 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0263 |
| Hersteller Artikelnummer: | A0263 |
| Alternativnummer: | ABB-A0263-100UL,ABB-A0263-20UL,ABB-A0263-500UL,ABB-A0263-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P53, BCC7, LFS1, BMFS5, TRP53, p53 |
| This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 44kDa |
| NCBI: | 7157 |
| UniProt: | P04637 |
| Reinheit: | Affinity purification |
| Sequenz: | MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII |
| Target-Kategorie: | TP53 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,DNA Damage Repair,Protein phosphorylation,Cancer,Tumor suppressors,p53 pathway,Signal Transduction,PI3K-Akt Signaling Pathway,ErbB-HER Signaling Pathway,MAPK-JNK Signaling Pathway,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Cell cycle inhibitors,Cell Cycle Control-G1 S Checkpoint,Cell Cycle Control-G2 M DNA Damage Checkpoint,Endocrine Metabolism,AMPK Signaling Pathway,Warburg Effect,Neuroscience,Neurodegenerative Diseases |


