VCAM1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: VCAM1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0279
• Hersteller Artikelnummer: A0279
• Alternativnummer: ABB-A0279-100UL,ABB-A0279-20UL,ABB-A0279-1000UL,ABB-A0279-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CD106, INCAM-100, VCAM1

Produktbeschreibung

This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 81kDa
• NCBI: 7412
• UniProt: P19320
• Reinheit: Affinity purification
• Sequenz: NRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVEL
• Target-Kategorie: VCAM1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Neuroscience,Stem Cells,Mesenchymal Stem Cells,Cardiovascular

Bilder