APOE Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0304
- Bilder (5)
| Artikelname: | APOE Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0304 |
| Hersteller Artikelnummer: | A0304 |
| Alternativnummer: | ABB-A0304-100UL,ABB-A0304-20UL,ABB-A0304-1000UL,ABB-A0304-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AD2, LPG, APO-E, ApoE4, LDLCQ5, APOE |
| The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 36 kDa |
| NCBI: | 348 |
| UniProt: | P02649 |
| Reinheit: | Affinity purification |
| Sequenz: | GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWA |
| Target-Kategorie: | APOE |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:5000|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Stem Cells,Cardiovascular,Lipids. |





