N-Cadherin Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: N-Cadherin Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0433
• Hersteller Artikelnummer: A0433
• Alternativnummer: ABB-A0433-100UL,ABB-A0433-20UL,ABB-A0433-500UL,ABB-A0433-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CDHN, NCAD, ACOGS, ADHD8, CD325, ARVD14, CDw325, N-Cadherin

Produktbeschreibung

This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 100kDa
• NCBI: 1000
• UniProt: P19022
• Reinheit: Affinity purification
• Sequenz: RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
• Target-Kategorie: CDH2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Adhesion,Cadherins,Tight Junctions,Cytoskeleton,Wnt -Catenin Signaling Pathway,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors

Bilder