Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0461
• Hersteller Artikelnummer: A0461
• Alternativnummer: ABB-A0461-100UL,ABB-A0461-20UL,ABB-A0461-500UL,ABB-A0461-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FAS, OA-519, SDR27X1, Fatty Acid Synthase (FASN)

Produktbeschreibung

The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 273kDa
• NCBI: 2194
• UniProt: P49327
• Reinheit: Affinity purification
• Sequenz: SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVH
• Target-Kategorie: FASN
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,AMPK Signaling Pathway,Neuroscience,Cardiovascular,Lipids,Fatty Acids

Bilder