Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0461
Artikelname: Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0461
Hersteller Artikelnummer: A0461
Alternativnummer: ABB-A0461-100UL,ABB-A0461-20UL,ABB-A0461-500UL,ABB-A0461-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FAS, OA-519, SDR27X1, Fatty Acid Synthase (FASN)
The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
Klonalität: Polyclonal
Molekulargewicht: 273kDa
NCBI: 2194
UniProt: P49327
Reinheit: Affinity purification
Sequenz: SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVH
Target-Kategorie: FASN
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,AMPK Signaling Pathway,Neuroscience,Cardiovascular,Lipids,Fatty Acids.
Western blot analysis of various lysates, using Fatty Acid Synthase (FASN) Rabbit pAb (A0461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
Western blot analysis of lysates from Rat liver, using Fatty Acid Synthase (FASN) Rabbit pAb (A0461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
Western blot analysis of various lysates using Fatty Acid Synthase (FASN) Rabbit pAb (A0461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of lysates from MCF7 cells, using Fatty Acid Synthase (FASN) Rabbit pAb (A0461) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
Western blot analysis of various lysates, using Fatty Acid Synthase (FASN) Rabbit pAb (A0461) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
Western blot analysis of lysates from wild type(WT) and Fatty Acid Synthase (FASN) Rabbit pAb knockout (KO) HeLa cells, using Fatty Acid Synthase (FASN) Rabbit pAb (A0461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
Western blot analysis of lysates from wild type (WT) and Fatty Acid Synthase (FASN) knockout (KO) Hela(KO) cells, using Fatty Acid Synthase (FASN) (A0461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Fatty Acid Synthase (FASN) Rabbit pAb (A0461) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis ofHeLa cells usingFatty Acid Synthase (FASN) Rabbit pAb(A0461) atadilution of1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution.Blue: DAPI for nuclear staining.