PKC delta Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: PKC delta Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0471
• Hersteller Artikelnummer: A0471
• Alternativnummer: ABB-A0471-100UL,ABB-A0471-20UL,ABB-A0471-500UL,ABB-A0471-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MAY1, PKCD, ALPS3, CVID9, nPKC-delta, PKC delta

Produktbeschreibung

The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progression. Also, this protein can positively or negatively regulate apoptosis. Defects in this gene are a cause of autoimmune lymphoproliferative syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 78kDa
• NCBI: 5580
• UniProt: Q05655
• Reinheit: Affinity purification
• Sequenz: MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHE
• Target-Kategorie: PRKCD
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Serine threonine kinases,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,TGF-b-Smad Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience

Bilder