N-Myc/MYCN Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: N-Myc/MYCN Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0499
• Hersteller Artikelnummer: A0499
• Alternativnummer: ABB-A0499-100UL,ABB-A0499-20UL,ABB-A0499-500UL,ABB-A0499-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NMYC, ODED, MODED, N-myc, bHLHe37, MYCNsORF, MYCNsPEP, N-Myc/MYCN

Produktbeschreibung

This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 50kDa
• NCBI: 4613
• UniProt: P04198
• Reinheit: Affinity purification
• Sequenz: AGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDED
• Target-Kategorie: MYCN
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Signal Transduction,MAPK-Erk Signaling Pathway

Bilder