[KO Validated] HK1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: [KO Validated] HK1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0533
• Hersteller Artikelnummer: A0533
• Alternativnummer: ABB-A0533-100UL,ABB-A0533-20UL,ABB-A0533-500UL,ABB-A0533-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HK, HKD, HKI, HXK1, NMSR, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase, K1

Produktbeschreibung

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0256]
• Molekulargewicht: 102kDa
• NCBI: 3098
• UniProt: P19367
• Reinheit: Affinity purification
• Sequenz: GLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPV
• Target-Kategorie: HK1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|IF/ICC,1:200 - 1:800|IF-P,1:200 - 1:800|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assa
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Warburg Effect,Cardiovascular,Blood,Heart

Bilder