NEDD4 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NEDD4 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0552
• Hersteller Artikelnummer: A0552
• Alternativnummer: ABB-A0552-100UL,ABB-A0552-20UL,ABB-A0552-1000UL,ABB-A0552-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RPF1, NEDD4-1, NEDD4

Produktbeschreibung

This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multiple tryptophan-rich WW domains and, a C-terminal HECT ubiquitin ligase catalytic domain. It plays critical role in the regulation of a number of membrane receptors, endocytic machinery components and the tumor suppressor PTEN.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 149kDa
• NCBI: 4734
• UniProt: P46934
• Reinheit: Affinity purification
• Sequenz: GSYSSNGSDFGSCASITSGGSYTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDDLEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFIISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNTPRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIK
• Target-Kategorie: NEDD4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation,Neuroscience

Bilder