SOX2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SOX2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0561
• Hersteller Artikelnummer: A0561
• Alternativnummer: ABB-A0561-100UL,ABB-A0561-20UL,ABB-A0561-500UL,ABB-A0561-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ANOP3, MCOPS3, SOX2

Produktbeschreibung

This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 34kDa
• NCBI: 6657
• UniProt: P48431
• Reinheit: Affinity purification
• Sequenz: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA
• Target-Kategorie: SOX2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Cell Biology Developmental Biology,ESC Pluripotency and Differentiation,Neuroscience, Cell Type Marker,Stem Cells,Embryonic Stem Cells,Germline Stem Cells

Bilder