PEBP1 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0578
- Bilder (2)
| Artikelname: | PEBP1 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0578 |
| Hersteller Artikelnummer: | A0578 |
| Alternativnummer: | ABB-A0578-20UL,ABB-A0578-100UL,ABB-A0578-1000UL,ABB-A0578-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PBP, HCNP, PEBP, RKIP, HCNPpp, PEBP-1, HEL-210, HEL-S-34, HEL-S-96, PEBP1 |
| This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 21kDa |
| NCBI: | 5037 |
| UniProt: | P30086 |
| Reinheit: | Affinity purification |
| Sequenz: | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK |
| Target-Kategorie: | PEBP1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor suppressors,Kinase,Cell Biology Developmental Biology,Cell Cycle,Neuroscience |
|
|
|
|
|
Produktgarantie und fachkundiger Support
