EEA1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0592
Artikelname: EEA1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0592
Hersteller Artikelnummer: A0592
Alternativnummer: ABB-A0592-100UL,ABB-A0592-20UL,ABB-A0592-1000UL,ABB-A0592-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MST105, ZFYVE2, MSTP105, EEA1
Enables 1-phosphatidylinositol binding activity, GTP-dependent protein binding activity, and protein homodimerization activity. Involved in endocytosis, vesicle fusion, and viral RNA genome replication. Located in cytosol and early endosome. Is extrinsic component of plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 162kDa
NCBI: 8411
UniProt: Q15075
Reinheit: Affinity purification
Sequenz: LKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Target-Kategorie: EEA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience, Cell Type Marker,Neuron marker