EEA1 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0592
- Bilder (2)
| Artikelname: | EEA1 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0592 |
| Hersteller Artikelnummer: | A0592 |
| Alternativnummer: | ABB-A0592-100UL,ABB-A0592-20UL,ABB-A0592-1000UL,ABB-A0592-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MST105, ZFYVE2, MSTP105, EEA1 |
| Enables 1-phosphatidylinositol binding activity, GTP-dependent protein binding activity, and protein homodimerization activity. Involved in endocytosis, vesicle fusion, and viral RNA genome replication. Located in cytosol and early endosome. Is extrinsic component of plasma membrane. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 162kDa |
| NCBI: | 8411 |
| UniProt: | Q15075 |
| Reinheit: | Affinity purification |
| Sequenz: | LKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG |
| Target-Kategorie: | EEA1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience, Cell Type Marker,Neuron marker |


