MED4 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: MED4 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0623
• Hersteller Artikelnummer: A0623
• Alternativnummer: ABB-A0623-20UL,ABB-A0623-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ARC36, VDRIP, DRIP36, TRAP36, HSPC126, MED4

Produktbeschreibung

This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC2528]
• Molekulargewicht: 30kDa
• NCBI: 29079
• UniProt: Q9NPJ6
• Reinheit: Affinity purification
• Sequenz: KYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKE
• Target-Kategorie: MED4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling

Bilder