Histone H1.2 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: Histone H1.2 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0646
• Hersteller Artikelnummer: A0646
• Alternativnummer: ABB-A0646-20UL,ABB-A0646-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: H1C, H1.2, H1F2, H1s-1, HIST1H1C, Histone H1.2

Produktbeschreibung

Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1836]
• Molekulargewicht: 21kDa
• NCBI: 3006
• UniProt: P16403
• Reinheit: Affinity purification
• Sequenz: MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG
• Target-Kategorie: H1-2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 -1:5000|IF/ICC,1:50 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Other (Wide Range Predicted). ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair

Bilder