SNRPA1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: SNRPA1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0647
• Hersteller Artikelnummer: A0647
• Alternativnummer: ABB-A0647-100UL,ABB-A0647-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Lea1, U2A, SNRPA1

Produktbeschreibung

Enables RNA binding activity. Involved in mRNA splicing, via spliceosome and spermatogenesis. Located in nuclear speck. Part of U2-type catalytic step 2 spliceosome and U2-type precatalytic spliceosome. Implicated in connective tissue disease.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC2532]
• Molekulargewicht: 28 kDa
• NCBI: 6627
• UniProt: P09661
• Reinheit: Affinity purification
• Sequenz: QEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS
• Target-Kategorie: SNRPA1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Immunology Inflammation

Bilder