CSK Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: CSK Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0666
• Hersteller Artikelnummer: A0666
• Alternativnummer: ABB-A0666-20UL,ABB-A0666-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CSK, tyrosine-protein kinase CSK

Produktbeschreibung

The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-receptor type 22 (PTPN22) gene. This protein also phosphorylates C-terminal tyrosine residues on multiple substrates, including the protein encoded by the SRC proto-oncogene, non-receptor tyrosine kinase gene. Phosphorylation suppresses the kinase activity of the Src family tyrosine kinases. An intronic polymorphism (rs34933034) in this gene has been found to affect B-cell activation and is associated with systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1835]
• Molekulargewicht: 51kDa
• NCBI: 1445
• UniProt: P41240
• Reinheit: Affinity purification
• Sequenz: MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE
• Target-Kategorie: CSK
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Immunology Inflammation,B Cell Receptor Signaling Pathway

Bilder