S100B Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: S100B Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0676
• Hersteller Artikelnummer: A0676
• Alternativnummer: ABB-A0676-100UL,ABB-A0676-20UL,ABB-A0676-1000UL,ABB-A0676-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NEF, S100, S100-B, S100beta, S100B

Produktbeschreibung

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21, however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimers disease, Downs syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 11kDa
• NCBI: 6285
• UniProt: P04271
• Reinheit: Affinity purification
• Sequenz: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
• Target-Kategorie: S100B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell differentiation,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells

Bilder