ACVR1C Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ACVR1C Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0678
• Hersteller Artikelnummer: A0678
• Alternativnummer: ABB-A0678-20UL,ABB-A0678-100UL,ABB-A0678-500UL,ABB-A0678-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ALK7, ACVRLK7, ACVR1C

Produktbeschreibung

ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 55kDa
• NCBI: 130399
• UniProt: Q8NER5
• Reinheit: Affinity purification
• Sequenz: LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
• Target-Kategorie: ACVR1C
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Kinase,Apoptosis,Growth factors

Bilder