ATG13 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0690
Artikelname: ATG13 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0690
Hersteller Artikelnummer: A0690
Alternativnummer: ABB-A0690-100UL,ABB-A0690-20UL,ABB-A0690-1000UL,ABB-A0690-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KIAA0652, PARATARG8, ATG13
The protein encoded by this gene is an autophagy factor and a target of the TOR kinase signaling pathway. The encoded protein is essential for autophagosome formation and mitophagy.
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 9776
UniProt: O75143
Reinheit: Affinity purification
Sequenz: ADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLS
Target-Kategorie: ATG13
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism