ATG13 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0690
- Bilder (2)
| Artikelname: | ATG13 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0690 |
| Hersteller Artikelnummer: | A0690 |
| Alternativnummer: | ABB-A0690-100UL,ABB-A0690-20UL,ABB-A0690-1000UL,ABB-A0690-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0652, PARATARG8, ATG13 |
| The protein encoded by this gene is an autophagy factor and a target of the TOR kinase signaling pathway. The encoded protein is essential for autophagosome formation and mitophagy. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 57kDa |
| NCBI: | 9776 |
| UniProt: | O75143 |
| Reinheit: | Affinity purification |
| Sequenz: | ADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLS |
| Target-Kategorie: | ATG13 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism |


