ATG7 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ATG7 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0691
• Hersteller Artikelnummer: A0691
• Alternativnummer: ABB-A0691-100UL,ABB-A0691-20UL,ABB-A0691-500UL,ABB-A0691-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GSA7, APG7L, SCAR31, APG7-LIKE, ATG7

Produktbeschreibung

This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 78kDa
• NCBI: 10533
• UniProt: O95352
• Reinheit: Affinity purification
• Sequenz: LGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFL
• Target-Kategorie: ATG7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Autophagy,Ubiquitin,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation,Cardiovascular,Heart

Bilder

Immunohistochemist