SOCS3 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0694
- Bilder (2)
| Artikelname: | SOCS3 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0694 |
| Hersteller Artikelnummer: | A0694 |
| Alternativnummer: | ABB-A0694-100UL,ABB-A0694-20UL,ABB-A0694-500UL,ABB-A0694-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CIS3, SSI3, ATOD4, Cish3, SSI-3, SOCS-3, SOCS3 |
| This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 25kDa |
| NCBI: | 9021 |
| UniProt: | O14543 |
| Reinheit: | Affinity purification |
| Sequenz: | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
| Target-Kategorie: | SOCS3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Obesity,Immunology Inflammation,Cytokines,Jak-Stat-IL-6 Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells,Hematopoietic Progenitors |


