BMP7 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0697
- Bilder (2)
| Artikelname: | BMP7 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0697 |
| Hersteller Artikelnummer: | A0697 |
| Alternativnummer: | ABB-A0697-20UL,ABB-A0697-100UL,ABB-A0697-1000UL,ABB-A0697-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | OP-1, BMP7 |
| This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone, kidney and brown adipose tissue development. Additionally, this protein induces ectopic bone formation and may promote fracture healing in human patients. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 49kDa |
| NCBI: | 655 |
| UniProt: | P18075 |
| Reinheit: | Affinity purification |
| Sequenz: | PHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVET |
| Target-Kategorie: | BMP7 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Cytoskeleton,Extracellular Matrix,Bone,Growth factors,TGF-b-Smad Signaling Pathway,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Endocrine Metabolism,Lipid Metabolism,Immunology Inflammation,Cytokines,NF-kB Signaling Pathway,Stem Cells |
|
|
|
|
|
Produktgarantie und fachkundiger Support
