Desmin Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Desmin Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0699
• Hersteller Artikelnummer: A0699
• Alternativnummer: ABB-A0699-100UL,ABB-A0699-20UL,ABB-A0699-1000UL,ABB-A0699-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CSM1, CSM2, CDCD3, LGMD1D, LGMD1E, LGMD2R, Desmin

Produktbeschreibung

This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 54kDa
• NCBI: 1674
• UniProt: P17661
• Reinheit: Affinity purification
• Sequenz: MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLD
• Target-Kategorie: DES
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Cardiac arrhythmias

Bilder