HBG1/2 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: HBG1/2 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0704
• Hersteller Artikelnummer: A0704
• Alternativnummer: ABB-A0704-20UL,ABB-A0704-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HBG-T2, HBGA, HBGR, HSGGL1, PRO2979, HBG1/2

Produktbeschreibung

The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5-epsilon -- gamma-G -- gamma-A -- delta -- beta--3. [provided by RefSeq, Jul 2008]

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1838]
• Molekulargewicht: 12 kDa
• NCBI: 3047
• UniProt: P69891
• Reinheit: Affinity purification
• Sequenz: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVD
• Target-Kategorie: HBG1/2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cardiovascular Blood Serum ProteinsCardiovascular Blood Other

Bilder