TSC1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: TSC1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0720
• Hersteller Artikelnummer: A0720
• Alternativnummer: ABB-A0720-20UL,ABB-A0720-100UL,ABB-A0720-500UL,ABB-A0720-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LAM, TSC, TSC1

Produktbeschreibung

This gene is a tumor suppressor gene that encodes the growth inhibitory protein hamartin. The encoded protein interacts with and stabilizes the GTPase activating protein tuberin. This hamartin-tuberin complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. This protein also functions as a co-chaperone for Hsp90 that inhibits its ATPase activity. This protein functions as a facilitator of Hsp90-mediated folding of kinase and non-kinase clients, including TSC2 and thereby preventing their ubiquitination and proteasomal degradation. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 130kDa
• NCBI: 7248
• UniProt: Q92574
• Reinheit: Affinity purification
• Sequenz: QPPPYDHLFEVALPKTAHHFVIRKTEELLKKAKGNTEEDGVPSTSPMEVLDRLIQQGADAHSKELNKLPLPSKSVDWTHFGGSPPSDEIRTLRDQLLLLHN
• Target-Kategorie: TSC1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Tumor suppressors,Signal Transduction,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Autophagy,Cell Cycle,Cell cycle inhibitors,Endocrine Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Obesity

Bilder