SOCS3 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0769
Artikelname: SOCS3 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0769
Hersteller Artikelnummer: A0769
Alternativnummer: ABB-A0769-100UL,ABB-A0769-20UL,ABB-A0769-500UL,ABB-A0769-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CIS3, SSI3, ATOD4, Cish3, SSI-3, SOCS-3, SOCS3
This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development.
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 9021
UniProt: O14543
Reinheit: Affinity purification
Sequenz: SFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Target-Kategorie: SOCS3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Obesity,Immunology Inflammation,Cytokines,Jak-Stat-IL-6 Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells,Hematopoietic Progenitors