SR-BI Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: SR-BI Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0827
• Hersteller Artikelnummer: A0827
• Alternativnummer: ABB-A0827-20UL,ABB-A0827-100UL,ABB-A0827-500UL,ABB-A0827-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CLA1, SRB1, CLA-1, SR-BI, CD36L1, HDLCQ6, HDLQTL6

Produktbeschreibung

The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2 and facilitates cell entry by the virus, SARS-CoV2.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0334]
• Molekulargewicht: 61kDa
• NCBI: 949
• UniProt: Q8WTV0
• Reinheit: Affinity purification
• Sequenz: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK
• Target-Kategorie: SCARB1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:2000 - 1:10000|IHC-P,1:400 - 1:1600|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Lipids

Bilder