RBP1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10029
Artikelname: RBP1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10029
Hersteller Artikelnummer: A10029
Alternativnummer: ABB-A10029-20UL,ABB-A10029-100UL,ABB-A10029-1000UL,ABB-A10029-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CRBP, RBPC, CRBP1, CRBPI, hCRBP1, CRABP-I, RBP1
This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 5947
UniProt: P09455
Reinheit: Affinity purification
Sequenz: MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEE
Target-Kategorie: RBP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction