SUCLA2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SUCLA2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A10040
• Hersteller Artikelnummer: A10040
• Alternativnummer: ABB-A10040-20UL,ABB-A10040-100UL,ABB-A10040-1000UL,ABB-A10040-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: A-SCS, A-BETA, MTDPS5, LINC00444, SCS-betaA, SUCLA2

Produktbeschreibung

Succinyl-CoA synthetase (SCS) is a mitochondrial matrix enzyme that acts as a heterodimer, being composed of an invariant alpha subunit and a substrate-specific beta subunit. The protein encoded by this gene is an ATP-specific SCS beta subunit that dimerizes with the SCS alpha subunit to form SCS-A, an essential component of the tricarboxylic acid cycle. SCS-A hydrolyzes ATP to convert succinate to succinyl-CoA. Defects in this gene are a cause of myopathic mitochondrial DNA depletion syndrome. A pseudogene of this gene has been found on chromosome 6.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 50kDa
• NCBI: 8803
• UniProt: Q9P2R7
• Reinheit: Affinity purification
• Sequenz: MAASMFYGRLVAVATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGP
• Target-Kategorie: SUCLA2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Neuroscience,Cardiovascular,Heart

Bilder