14-3-3 alpha/beta Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1023
Artikelname: 14-3-3 alpha/beta Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1023
Hersteller Artikelnummer: A1023
Alternativnummer: ABB-A1023-100UL,ABB-A1023-20UL,ABB-A1023-500UL,ABB-A1023-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HS1, GW128, YWHAA, KCIP-1, HEL-S-1, 14-3-3 alpha/beta
This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene.
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 7529
UniProt: P31946
Reinheit: Affinity purification
Sequenz: AYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Target-Kategorie: YWHAB
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,G protein signaling,Kinase,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Cell Cycle Control-G2 M DNA Damage Checkpoint,Immunology Inflammation,Neuroscience, Cell Type Marker,Stem Cells,Neuron marker,Synapse marker