SNAPIN Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10294
Artikelname: SNAPIN Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10294
Hersteller Artikelnummer: A10294
Alternativnummer: ABB-A10294-100UL,ABB-A10294-20UL,ABB-A10294-1000UL,ABB-A10294-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BLOS7, BORCS3, SNAPAP, BLOC1S7, SNAPIN
The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 23557
UniProt: O95295
Reinheit: Affinity purification
Sequenz: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Target-Kategorie: SNAPIN
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker