MTAP Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MTAP Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1049
• Hersteller Artikelnummer: A1049
• Alternativnummer: ABB-A1049-100UL,ABB-A1049-20UL,ABB-A1049-500UL,ABB-A1049-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BDMF, MSAP, DMSFH, LGMBF, DMSMFH, c86fus, HEL-249, MTAP

Produktbeschreibung

This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage pathway of both adenine and methionine. The encoded enzyme is deficient in many cancers. Multiple alternatively spliced transcript variants have been described for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 31kDa
• NCBI: 4507
• UniProt: Q13126
• Reinheit: Affinity purification
• Sequenz: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTI
• Target-Kategorie: MTAP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism

Bilder