14-3-3 epsilon Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: 14-3-3 epsilon Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1058
• Hersteller Artikelnummer: A1058
• Alternativnummer: ABB-A1058-100UL,ABB-A1058-20UL,ABB-A1058-1000UL,ABB-A1058-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MDS, HEL2, MDCR, KCIP-1, 14-3-3E, 14-3-3 epsilon

Produktbeschreibung

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 29kDa
• NCBI: 7531
• UniProt: P62258
• Reinheit: Affinity purification
• Sequenz: KGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTEL
• Target-Kategorie: YWHAE
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Cell Cycle Control-G2 M DNA Damage Checkpoint,Neuroscience, Cell Type Marker,Dopamine Signaling in Parkinsons Disease,Neurodegenerative Diseases Markers,Stem Cells,Neuron marker,Synapse marker

Bilder