Calreticulin Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Calreticulin Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1066
• Hersteller Artikelnummer: A1066
• Alternativnummer: ABB-A1066-100UL,ABB-A1066-20UL,ABB-A1066-500UL,ABB-A1066-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RO, CRT, SSA, cC1qR, HEL-S-99n, Calreticulin

Produktbeschreibung

Calreticulin is a highly conserved chaperone protein which resides primarily in the endoplasmic reticulum, and is involved in a variety of cellular processes, among them, cell adhesion. Additionally, it functions in protein folding quality control and calcium homeostasis. Calreticulin is also found in the nucleus, suggesting that it may have a role in transcription regulation. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin. Recurrent mutations in calreticulin have been linked to various neoplasms, including the myeloproliferative type.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 47kDa
• NCBI: 811
• UniProt: P27797
• Reinheit: Affinity purification
• Sequenz: EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFL
• Target-Kategorie: CALR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Apoptosis

Bilder