TNFRSF17 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10707
Artikelname: TNFRSF17 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10707
Hersteller Artikelnummer: A10707
Alternativnummer: ABB-A10707-20UL,ABB-A10707-100UL,ABB-A10707-1000UL,ABB-A10707-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BCM, BCMA, CD269, TNFRSF13A, TNFRSF17
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 608
UniProt: Q02223
Reinheit: Affinity purification
Sequenz: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMA
Target-Kategorie: TNFRSF17
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,CDs,NF-kB Signaling Pathway