FAM3B Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1082
Artikelname: FAM3B Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1082
Hersteller Artikelnummer: A1082
Alternativnummer: ABB-A1082-100UL,ABB-A1082-20UL,ABB-A1082-1000UL,ABB-A1082-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: 2-21, ORF9, PANDER, PRED44, C21orf11, C21orf76, FAM3B
Involved in insulin secretion. Located in extracellular exosome.
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 54097
UniProt: P58499
Reinheit: Affinity purification
Sequenz: ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Target-Kategorie: FAM3B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200|IF/ICC,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway