FAM3B Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A1082
- Bilder (2)
| Artikelname: | FAM3B Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A1082 |
| Hersteller Artikelnummer: | A1082 |
| Alternativnummer: | ABB-A1082-100UL,ABB-A1082-20UL,ABB-A1082-1000UL,ABB-A1082-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 2-21, ORF9, PANDER, PRED44, C21orf11, C21orf76, FAM3B |
| Involved in insulin secretion. Located in extracellular exosome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 26kDa |
| NCBI: | 54097 |
| UniProt: | P58499 |
| Reinheit: | Affinity purification |
| Sequenz: | ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
| Target-Kategorie: | FAM3B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IHC-P,1:100 - 1:200|IF/ICC,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway |


