CTGF Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11067
Artikelname: CTGF Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11067
Hersteller Artikelnummer: A11067
Alternativnummer: ABB-A11067-20UL,ABB-A11067-100UL,ABB-A11067-500UL,ABB-A11067-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CTGF, NOV2, HCS24, IGFBP8
The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 1490
UniProt: P29279
Reinheit: Affinity purification
Sequenz: GAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCL
Target-Kategorie: CCN2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:10000|IF/ICC,1:20 - 1:100|IF-P,1:20 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Cardiovascular,Angiogenesis