Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11102
Artikelname: Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11102
Hersteller Artikelnummer: A11102
Alternativnummer: ABB-A11102-100UL,ABB-A11102-20UL,ABB-A11102-1000UL,ABB-A11102-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HO-1, HSP32, HMOX1D, bK286B10, Heme Oxygenase 1 (HO-1/HMOX1)
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 3162
UniProt: P09601
Reinheit: Affinity purification
Sequenz: MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRG
Target-Kategorie: HMOX1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:100 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Immunology Inflammation,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Cardiovascular,Blood,Hypoxia