PKC alpha Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11107
Artikelname: PKC alpha Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11107
Hersteller Artikelnummer: A11107
Alternativnummer: ABB-A11107-100UL,ABB-A11107-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AAG6, PKCA, PRKACA, PKCI+/-, PKCalpha, PKC-alpha, PKC alpha
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0197]
Molekulargewicht: 77kDa
NCBI: 5578
UniProt: P17252
Reinheit: Affinity purification
Sequenz: MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Target-Kategorie: PRKCA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Serine threonine kinases,mTOR Signaling Pathway,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Cell Adhesion,Cytoskeleton,Microtubules,Actins,TGF-b-Smad Signaling Pathway,Endocrine Metabolism,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Neurodegenerative Diseases Markers,Cardiovascular,Heart,Hypertrophy