FAK Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11131
Artikelname: FAK Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11131
Hersteller Artikelnummer: A11131
Alternativnummer: ABB-A11131-20UL,ABB-A11131-100UL,ABB-A11131-1000UL,ABB-A11131-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FAK, FADK, FAK1, FRNK, FADK 1, PPP1R71, p125FAK, pp125FAK
This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0171]
Molekulargewicht: 119kDa
NCBI: 5747
UniProt: Q05397
Reinheit: Affinity purification
Sequenz: TVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIG
Target-Kategorie: PTK2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Tyrosine kinases,PI3K-Akt Signaling Pathway,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Actins,Extracellular Matrix,Immunology Inflammation,Cardiovascular,Angiogenesis