[KO Validated] CDK4 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11136
Artikelname: [KO Validated] CDK4 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11136
Hersteller Artikelnummer: A11136
Alternativnummer: ABB-A11136-100UL,ABB-A11136-20UL,ABB-A11136-1000UL,ABB-A11136-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CMM3, PSK-J3, K4
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51004]
Molekulargewicht: 34kDa
NCBI: 1019
UniProt: P11802
Reinheit: Affinity purification
Sequenz: FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Target-Kategorie: CDK4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.For high-ratio antibody
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat,Monkey, ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G1 S Checkpoint.
Western blot analysis of lysates from wild type(WT) and knockout (KO) HeLa cells, using [KO Validated] CDK4 Rabbit mAb (A11136) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KO Validated] CDK4 Rabbit mAb (A11136) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates, using [KO Validated] CDK4 Rabbit mAb (A11136) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] CDK4 Rabbit mAb (A11136) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KO Validated] CDK4 Rabbit mAb (A11136) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KO Validated] CDK4 Rabbit mAb (A11136) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human prostate tissue using [KO Validated] CDK4 Rabbit mAb (A11136) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunoprecipitation of CDK4 from 300 µg extracts of HeLa was performed using 0.5 µg of [KO Validated] CDK4 Rabbit mAb (A11136). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] CDK4 Rabbit mAb (A11136) at a dilution of 1:1000.
Immunoprecipitation of CDK4 from 300 µg extracts of NIH/3T3 was performed using 2 µg of [KO Validated] CDK4 Rabbit mAb (A11136). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] CDK4 Rabbit mAb (A11136) at a dilution of 1:1000.