NF-kB p65/RelA Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11204
Artikelname: NF-kB p65/RelA Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11204
Hersteller Artikelnummer: A11204
Alternativnummer: ABB-A11204-100UL,ABB-A11204-20UL,ABB-A11204-1000UL,ABB-A11204-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: p65, CMCU, NFKB3, AIF3BL3, NF-kB p65/RelA
NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 5970
UniProt: Q04206
Reinheit: Affinity purification
Sequenz: LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Target-Kategorie: RELA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Jak-Stat-IL-6 Receptor Signaling Pathway,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Cardiovascular