STAT3 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11216
Artikelname: STAT3 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11216
Hersteller Artikelnummer: A11216
Alternativnummer: ABB-A11216-100UL,ABB-A11216-20UL,ABB-A11216-1000UL,ABB-A11216-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: APRF, HIES, ADMIO, ADMIO1, STAT3
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome.
Klonalität: Polyclonal
Molekulargewicht: 88kDa
NCBI: 6774
UniProt: P40763
Reinheit: Affinity purification
Sequenz: TKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG
Target-Kategorie: STAT3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Signal Transduction,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Microtubules,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway,Stem Cells,Embryonic Stem Cells,Cardiovascular,Heart,Cardiogenesis,Hypertrophy