Ku70 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11223
Artikelname: Ku70 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11223
Hersteller Artikelnummer: A11223
Alternativnummer: ABB-A11223-20UL,ABB-A11223-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ML8, KU70, TLAA, CTC75, CTCBF, G22P1, Ku70
The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0551]
Molekulargewicht: 70kDa
NCBI: 2547
UniProt: P12956
Reinheit: Affinity purification
Sequenz: PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
Target-Kategorie: XRCC6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:3000 - 1:20000|IHC-P,1:200 - 1:800|IF/ICC,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,RNA Binding,Cancer,Cell Biology Developmental Biology,Cell Cycle