AMACR Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: AMACR Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1130
• Hersteller Artikelnummer: A1130
• Alternativnummer: ABB-A1130-100UL,ABB-A1130-20UL,ABB-A1130-500UL,ABB-A1130-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RM, RACE, CBAS4, P504S, AMACRD, AMACR

Produktbeschreibung

This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 42kDa
• NCBI: 23600
• UniProt: Q9UHK6
• Reinheit: Affinity purification
• Sequenz: MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGR
• Target-Kategorie: AMACR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism

Bilder