GluR2/GRIA2 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11316
Artikelname: GluR2/GRIA2 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11316
Hersteller Artikelnummer: A11316
Alternativnummer: ABB-A11316-20UL,ABB-A11316-100UL,ABB-A11316-500UL,ABB-A11316-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B, GluR-K2, GluR2/GRIA2
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to a family of glutamate receptors that are sensitive to alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA), and function as ligand-activated cation channels. These channels are assembled from 4 related subunits, GRIA1-4. The subunit encoded by this gene (GRIA2) is subject to RNA editing (CAG->CGG, Q->R) within the second transmembrane domain, which is thought to render the channel impermeable to Ca(2+). Human and animal studies suggest that pre-mRNA editing is essential for brain function, and defective GRIA2 RNA editing at the Q/R site may be relevant to amyotrophic lateral sclerosis (ALS) etiology. Alternative splicing, resulting in transcript variants encoding different isoforms, (including the flip and flop isoforms that vary in their signal transduction properties), has been noted for this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0572]
Molekulargewicht: 99kDa
NCBI: 2891
UniProt: P42262
Reinheit: Affinity purification
Sequenz: YLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKI
Target-Kategorie: GRIA2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IF-P,1:100 - 1:1000|IHC-P,1:100 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Dopamine Signaling in Parkinsons Disease