CTCF Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1133
Artikelname: CTCF Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1133
Hersteller Artikelnummer: A1133
Alternativnummer: ABB-A1133-100UL,ABB-A1133-20UL,ABB-A1133-1000UL,ABB-A1133-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MRD21, FAP108, CFAP108, CTCF
This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms tumors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 10664
UniProt: P49711
Reinheit: Affinity purification
Sequenz: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPT
Target-Kategorie: CTCF
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200|ChIP,5µg antibody for 10µg-15µg of Chromatin|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration base
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling