DDX5 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11339
Artikelname: DDX5 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11339
Hersteller Artikelnummer: A11339
Alternativnummer: ABB-A11339-100UL,ABB-A11339-20UL,ABB-A11339-500UL,ABB-A11339-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: p68, HLR1, G17P1, HUMP68, DDX5
This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0575]
Molekulargewicht: 69kDa
NCBI: 1655
UniProt: P17844
Reinheit: Affinity purification
Sequenz: MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEAN
Target-Kategorie: DDX5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|IHC-P,1:200 - 1:2000|IF/ICC,1:200 - 1:2000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding